NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0164305_10092339

Scaffold Ga0164305_10092339


Overview

Basic Information
Taxon OID3300012989 Open in IMG/M
Scaffold IDGa0164305_10092339 Open in IMG/M
Source Dataset NameSoil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1919
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Amended Soil Microbial Communities From New York, Usa To Study Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Mt. Pleasant research farm, Cornell University, New York
CoordinatesLat. (o)42.4531Long. (o)-76.3842Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005793Metagenome / Metatranscriptome390Y
F006999Metagenome / Metatranscriptome360Y

Sequences

Protein IDFamilyRBSSequence
Ga0164305_100923392F005793N/AMRKSVILVLFAVMPHSSVLAKEGLLNSSYEEVASILGKPSSHDNGNVSGIRYDRYHFEARGWKAAILFIDGKAQKLDTEKSDGSPLSVEDKKAIFEAYDVPNTGQDSKLRGWRQFSENHFIRGDGRVHIIAHPTSMTIFWDDLPREFW*
Ga0164305_100923393F006999N/AVWADEKEAMLHALGQFQQAWRSKPPCTISNNPCQTREIWLAQQAAQAADRYLDTREAKERYSRNWRLVALSVIKYSQVRTEAYAAYVHARHRDEAYHSIVYPLEQEFRADLKAALRSDVNSREIAQRFGLVDF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.