Scaffold Ga0159060_1000370

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0159060_1000370

Scaffold Ga0159060_1000370

Overview

Basic Information
Taxon OID	3300012990 Open in IMG/M
Scaffold ID	Ga0159060_1000370 Open in IMG/M
Source Dataset Name	Tailings pond microbial communities from Northern Alberta -TP6_2010 BML May 2015
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	McGill University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	15185
Total Scaffold Genes	41 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	30 (73.17%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Wastewater Microbial Communities From Base Mine Lake, Ft. Mcmurray, Alberta, Canada - Surface, May 2015

Source Dataset Sampling Location
Location Name	Canada: Alberta
Coordinates	Lat. (^o)	57.02	Long. (^o)	-111.55	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040583	Metagenome / Metatranscriptome	161	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0159060_100037029	F040583	AGGA	MFVYLVTLTTGQTVRVETAGDPTEHPAFFGRVLNVETLGMAGLHLV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.