Basic Information | |
---|---|
Taxon OID | 3300013006 Open in IMG/M |
Scaffold ID | Ga0164294_10063927 Open in IMG/M |
Source Dataset Name | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2809 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wisconsin | |||||||
Coordinates | Lat. (o) | 46.008 | Long. (o) | -89.701 | Alt. (m) | Depth (m) | 4 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001164 | Metagenome / Metatranscriptome | 760 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0164294_100639275 | F001164 | AGGA | MTLTEIAQYAGEKIGKTDADTLTFLQKAASLAYRRVWDFAPWRETVTNSTYSVGTNRLITLGNNVETPLSVAYNDAEVDPIDLATIISQDPGLLDDGRTGDPDTYHFTGRNSSGVAELNLYPRLATSGTIPLRVVEKLKCLTRTNYIVDFPPSSSALNDELRLPHVHH |
⦗Top⦘ |