NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0169967_1057861

Scaffold Ga0169967_1057861


Overview

Basic Information
Taxon OID3300013011 Open in IMG/M
Scaffold IDGa0169967_1057861 Open in IMG/M
Source Dataset NameGypsum crust endolithic microbial communities from the Atacama Desert, Chile - KM37
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJohns Hopkins Bayview Research CORES
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)686
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock → Gypsum Rock Endolithic And Hypoendolithic Microbial Communities

Source Dataset Sampling Location
Location NameChile: Atacama Desert
CoordinatesLat. (o)-20.43644Long. (o)-69.58397Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029653Metagenome / Metatranscriptome187Y

Sequences

Protein IDFamilyRBSSequence
Ga0169967_10578611F029653N/AVVPGYRVWRVIPGKWVAPSESLHAQTCHRTWSSTGPTEAYCPPRVQGDPGRPLIRSSSCESAPSFGCTCGLYARYEPVREKQRLPYVVGSVLAWGRVVHHEERSFFRAEKALPVAFVRPRGGGGAFPELSEDKLFRIAELLGAEVVEDSDELRVYTEEEADKW*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.