NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0170681_1007533

Scaffold Ga0170681_1007533


Overview

Basic Information
Taxon OID3300013026 Open in IMG/M
Scaffold IDGa0170681_1007533 Open in IMG/M
Source Dataset NameGypsum rock hypoendolithic microbial communities from the Atacama Desert, Chile - Cordon de Lila
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJohns Hopkins Bayview Research CORES
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2614
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock → Gypsum Rock Endolithic And Hypoendolithic Microbial Communities

Source Dataset Sampling Location
Location NameSite Cordon de Lila - Atacama Desert, Chile
CoordinatesLat. (o)-23.53976Long. (o)-68.68737Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064078Metagenome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0170681_10075332F064078N/AMSEEQEPPLEIEVLKWDAHSFTIEGVNEHLEKLLKEQKIIRTLSLRHNGQMGRLSRDVRLKARRDFTSEGDGDSRYVSTRGTTFEYEGLD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.