Scaffold Ga0116814_1000078

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0116814_1000078

Scaffold Ga0116814_1000078

Overview

Basic Information
Taxon OID	3300013230 Open in IMG/M
Scaffold ID	Ga0116814_1000078 Open in IMG/M
Source Dataset Name	Marine hypoxic microbial communities from the Gulf of Mexico, USA - 10m_Station5_GOM_Metagenome
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Georgia Institute of Technology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	9826
Total Scaffold Genes	14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (14.29%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Hypoxic Microbial Communities From The Gulf Of Mexico, Usa

Source Dataset Sampling Location
Location Name	USA: Gulf of Mexico
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085235	Metagenome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116814_100007810	F085235	N/A	MEAYLTPERVTLLRLMEVAGIEIVENASLCRERNDNFAGFTLSTPSTQFIEVIICTDAIVKHTISKVRTTLEINRTVDHEALHAAQFCKNDYYPGSVSDDMTTDNELEAQSYEDRPQAVGEQLIKFCF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.