NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116814_1006361

Scaffold Ga0116814_1006361


Overview

Basic Information
Taxon OID3300013230 Open in IMG/M
Scaffold IDGa0116814_1006361 Open in IMG/M
Source Dataset NameMarine hypoxic microbial communities from the Gulf of Mexico, USA - 10m_Station5_GOM_Metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Institute of Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1195
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → environmental samples → uncultured marine virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Hypoxic Microbial Communities From The Gulf Of Mexico, Usa

Source Dataset Sampling Location
Location NameUSA: Gulf of Mexico
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027831Metagenome193Y

Sequences

Protein IDFamilyRBSSequence
Ga0116814_10063611F027831N/AMPRGKQSGIAFGQRTKQKGQSDLDQLIRLKQFLKERFHMDFKREWYAGFDKEYGYLCRISESVGRKELERFKWKNPDLICYDKQHGIIIVELDGAIHDRKVRKTEERNELFRGAGIKLIVLNIADIKECGQTIIERLESEMLKLIGQH*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.