NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0172420_11034813

Scaffold Ga0172420_11034813


Overview

Basic Information
Taxon OID3300013233 Open in IMG/M
Scaffold IDGa0172420_11034813 Open in IMG/M
Source Dataset NameCombined Assembly of Gp0198154, Gp0198156, Gp0198157, Gp0198161
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterWestern Washington University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)614
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine → Marine Microbial Mat From Mariana Arc And Backarc, Pacific Ocean

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)12.916667Long. (o)143.633333Alt. (m)Depth (m)2931
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003161Metagenome504N

Sequences

Protein IDFamilyRBSSequence
Ga0172420_110348131F003161GAGLDRIDVLLSTISDPAFVAVIRAEPLALSGTPILAYWVQSRTNGWQTLTNIGSTTTIMVRAYFRLQASADVRESIELELWDSMVEVDTKLRSDANLDGNCTDSTVGAATVATLDMGGSLYRTATIPFSIQIYEEVSIVP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.