Scaffold Ga0171462_1021

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0171462_1021

Scaffold Ga0171462_1021

Overview

Basic Information
Taxon OID	3300013250 Open in IMG/M
Scaffold ID	Ga0171462_1021 Open in IMG/M
Source Dataset Name	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Universidade Estadual de Campinas
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	141297
Total Scaffold Genes	110 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	89 (80.91%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Amaranthaceae → Bosea	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rizhosphere → Microbial Communities Associated With Sugarcane

Source Dataset Sampling Location
Location Name	Campinas, S?o Paulo, Brazil
Coordinates	Lat. (^o)	-22.8187222	Long. (^o)	-47.05896667	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085519	Metagenome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0171462_1021105	F085519	N/A	MINRRFMIVPPALSSGGQTEKARQTSPEFLCLQLETANMRVERI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.