Scaffold Ga0136642_1002041

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136642_1002041

Scaffold Ga0136642_1002041

Overview

Basic Information
Taxon OID	3300013285 Open in IMG/M
Scaffold ID	Ga0136642_1002041 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8157
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (53.85%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From High-Altitude Lakes In Yosemite National Park, California, Usa

Source Dataset Sampling Location
Location Name	USA: Lower Cathedral Lake, Yosemite National Park, California, USA
Coordinates	Lat. (^o)	37.8453	Long. (^o)	-119.4233	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050889	Metagenome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136642_10020418	F050889	GGA	MKDLYSTPEARLDTILGEVSFWAQMQRCRTSEEGEKNCTTGADTITWFRDTWGIQLLPSDDTIFGFQRGVNILDEQKYMIFLLKWS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.