NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136642_1003014

Scaffold Ga0136642_1003014


Overview

Basic Information
Taxon OID3300013285 Open in IMG/M
Scaffold IDGa0136642_1003014 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6363
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (68.75%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From High-Altitude Lakes In Yosemite National Park, California, Usa

Source Dataset Sampling Location
Location NameUSA: Lower Cathedral Lake, Yosemite National Park, California, USA
CoordinatesLat. (o)37.8453Long. (o)-119.4233Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001008Metagenome / Metatranscriptome807Y
F007163Metagenome / Metatranscriptome356Y

Sequences

Protein IDFamilyRBSSequence
Ga0136642_100301410F007163GGAGMTLEDLQYIFEYQIEEGTENLYFMLNDGERLPLIQRHPSDDLAGLLPMLDSFQYTGHNVMPRFKK*
Ga0136642_100301413F001008N/AMSKAKHKPYQWIDGETADRITSMNLKDYRAYLKKELKQWKKNPKSDANPKGYWLHPEDVGINMQTIAALDLIISHFPVTPDDIK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.