 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300013289 Open in IMG/M |
| Scaffold ID | Ga0119916_104778 Open in IMG/M |
| Source Dataset Name | Activated sludge bacterial and viral communities from EBPR bioreactors in Queensland, Australia - SBR4-V91210 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | California Institute of Technology |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 691 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge → Activated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Australia: Queensland | |||||||
| Coordinates | Lat. (o) | -27.49999 | Long. (o) | 153.01209 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F095570 | Metagenome / Metatranscriptome | 105 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0119916_1047782 | F095570 | N/A | IMTEYLYDRDNPKSALRQRITGIEGFFYGLPNINERAEMVNRALLKENDNDITKFANQLKKPRDNA* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |