Scaffold Ga0170791_11421293

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0170791_11421293

Scaffold Ga0170791_11421293

Overview

Basic Information
Taxon OID	3300013295 Open in IMG/M
Scaffold ID	Ga0170791_11421293 Open in IMG/M
Source Dataset Name	northern Canada Lakes metatranscriptome co-assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1461
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location Name	Canada: Quebec
Coordinates	Lat. (^o)	46.8319	Long. (^o)	-72.5	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002303	Metagenome / Metatranscriptome	573	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0170791_114212931	F002303	N/A	REQCRERAIQFAKEWNCENVSNHILDIMVSIMCTRDKSSYAGGGFVEAVVANNLYLALSRADTDCRNNIFLLAMCKQNCFLNEYDY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.