NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157374_10126244

Scaffold Ga0157374_10126244


Overview

Basic Information
Taxon OID3300013296 Open in IMG/M
Scaffold IDGa0157374_10126244 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2473
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Lacipirellulaceae → Botrimarina → Botrimarina colliarenosi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038816Metagenome / Metatranscriptome165Y
F069787Metagenome123Y

Sequences

Protein IDFamilyRBSSequence
Ga0157374_101262441F038816GAGGMAQAHRTRLARNNVVQCEQEISYAGGVSFLWSRAKIRISALILFGTATPALVGFAFANPTVRWLCLVWLLGVALVMHGLSRRVSDVRVVLSVDHRGILDRRLMARRIEWHEIGAICRVDTDRSYTVDIRLRWPRTTLDQAVWLARGGALCQIGYGVPAVTFSMLLLAGDVSELLEAVAQY
Ga0157374_101262443F069787N/ADDRAAKIYAGQMGIAAVLVNVLIDKGVITQNELRERFEQAHKAAKNCSGGPVIAVVLEDMLQYLASPASEGLPSHYRS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.