NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0173631_1126740

Scaffold Ga0173631_1126740


Overview

Basic Information
Taxon OID3300013312 Open in IMG/M
Scaffold IDGa0173631_1126740 Open in IMG/M
Source Dataset NameSolar panel surface microbial communities from Valencia, Spain - panel 3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLifesequencing S.L.
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)503
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Solar Panel Surfaces → Solar Panel Surface Microbial Communities From Valencia, Spain

Source Dataset Sampling Location
Location NameValencia, Spain
CoordinatesLat. (o)39.4561165Long. (o)-0.3545661Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037234Metagenome / Metatranscriptome168Y

Sequences

Protein IDFamilyRBSSequence
Ga0173631_11267401F037234N/AMNEYLILDPKPSDLTMIRVIKARMVYRCKDIQRIVVS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.