NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0173629_10051732

Scaffold Ga0173629_10051732


Overview

Basic Information
Taxon OID3300013313 Open in IMG/M
Scaffold IDGa0173629_10051732 Open in IMG/M
Source Dataset NameMarine surface microbial communities from Baltic Sea. Combined Assembly of 24 SPs re-assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBerlin Center for Genomics in Biodiversity Research (BeGenDiv)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)529
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Marine → Marine Surface Microbial Communities From Baltic Sea - Bioacid_Cyano

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)57.32Long. (o)20.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080830Metagenome / Metatranscriptome114N

Sequences

Protein IDFamilyRBSSequence
Ga0173629_100517321F080830N/AVFAVLSQAGVAISDPITFYKGKKTKFWLPLEGEHLLVQTPDLGIYASVFKGPRADLQWFDRFFIKLPDGRIVAEVGVKRESINSNNTAPRDHRMFSQLDIKLGDSKVPLRKLQRTLFSFRDSSVKVGVGTQRFDPPRLHGQPVTEFVNVETASISFLLVAGHAGNEFPNDLELQKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.