Scaffold Ga0120127_10162891

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0120127_10162891

Scaffold Ga0120127_10162891

Overview

Basic Information
Taxon OID	3300013503 Open in IMG/M
Scaffold ID	Ga0120127_10162891 Open in IMG/M
Source Dataset Name	Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Tennessee
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	539
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Nunavut, Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location Name	Canada: Axel Heiberg Island, Nunavut
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)	.05
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100833	Metagenome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0120127_101628911	F100833	N/A	QGGGRVFISVNPEEVSLRPGEGVEWDFRYLGGADLAVDELVIEFERPSPFSTMAFKSRKPGTARPHRQLSGPVHKSSTGKRVGYTIRAMSPFKTELASSKLFLNTEL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.