Scaffold Ga0119802_1000010

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119802_1000010

Scaffold Ga0119802_1000010

Overview

Basic Information
Taxon OID	3300013751 Open in IMG/M
Scaffold ID	Ga0119802_1000010 Open in IMG/M
Source Dataset Name	Human oral microbial communities from Los Angeles, CA, USA - S14-02-D
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of California, Los Angeles
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	195379
Total Scaffold Genes	193 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	132 (68.39%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter showae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral → Human Oral Microbial Communities From Los Angeles, Ca, Usa

Source Dataset Sampling Location
Location Name	USA: Los Angeles
Coordinates	Lat. (^o)	34.0722	Long. (^o)	-118.4441	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085821	Metagenome	111	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0119802_100001088	F085821	AGGAG	MNDVFERLAPLAQTKKQQTAVAKFIEKGFKFTRQPDAQKFTFLVYDFFVAGNIPAVQLCIDYLVAQGYPTAENEKKFLNWIFMEPVYYLKYFISDASTQKKLHHNLLNLWYESTKRQILEHDKGKHDEAYIDAWVKANVNKTLSIIRSGETIASCKEDVAKHSRTINDEYEQNIGLLDEYCRALLYTAETTQSQQELVAQTQNHIALLKDLYKKVNKIK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.