NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120183_1000017

Scaffold Ga0120183_1000017


Overview

Basic Information
Taxon OID3300013754 Open in IMG/M
Scaffold IDGa0120183_1000017 Open in IMG/M
Source Dataset NameTerrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Institute of Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4194
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial → Terrestrial Microbial Communites From A Soil Warming Plot In Okalahoma, Usa

Source Dataset Sampling Location
Location NameUSA: Kessler Farm Field Laboratory (KFFL), Okalahoma
CoordinatesLat. (o)34.975667Long. (o)-97.519Alt. (m)Depth (m)200
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F093450Metagenome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0120183_10000173F093450N/AMCVRAQTSALGIAIRSDHLKREESKARESKVEITNTLNAEKDQQPQLSLVEFQAAEGSFRQPTAAEVSILTFWKLRYARSRAQELSNEFARLLNRGSSLE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.