NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120155_1124898

Scaffold Ga0120155_1124898


Overview

Basic Information
Taxon OID3300013768 Open in IMG/M
Scaffold IDGa0120155_1124898 Open in IMG/M
Source Dataset NamePermafrost microbial communities from Nunavut, Canada - A35_65cm_0M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Tennessee
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)707
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Nunavut, Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameCanada: Axel Heiberg Island, Nunavut
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m).65
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000280Metagenome / Metatranscriptome1383Y
F001935Metagenome / Metatranscriptome615Y
F101096Metagenome / Metatranscriptome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0120155_11248981F001935N/AVYTQHLSSLEFATYTAFLGVVCAALFRLLPGKAPPVRTEPHSAEELAAHDRRLPKYFLAGGGFLLLGSLHAVAKNLPWVAEELARGGYAGHLVRDLANTHV
Ga0120155_11248982F000280AGAAGGMARPRLRPARPLFGYRDIGAGAPRHSRGALTRAWLILAVMVLLYLAWTLTVYFLEPGLR*
Ga0120155_11248983F101096N/AHVQEYPGCQRFDVFVRTERDGKTHLHCYTTWDTPGQLEVYLERGYTLERLLADLGRGIVAERSLVMEKVF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.