Scaffold Ga0119894_1001294

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119894_1001294

Scaffold Ga0119894_1001294

Overview

Basic Information
Taxon OID	3300013793 Open in IMG/M
Scaffold ID	Ga0119894_1001294 Open in IMG/M
Source Dataset Name	Wastewater microbial communities from municipal sewage treatment plant in Nanjing, China - WX_AS_meta
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Nanjing University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2880
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (83.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Municipal Sewage Treatment Plants In Nanjing, China

Source Dataset Sampling Location
Location Name	China: Nanjing
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048673	Metagenome / Metatranscriptome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119894_10012941	F048673	N/A	MRTLATLLILVAIAASQPHHWLAVLMAAIAHCIGK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.