NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116637_1005805

Scaffold Ga0116637_1005805


Overview

Basic Information
Taxon OID3300013936 Open in IMG/M
Scaffold IDGa0116637_1005805 Open in IMG/M
Source Dataset NameBaboon gut microbial communities from fecal samples in Kenya - F28
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDuke University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1529
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Baboon Gut → Baboon Gut Microbial Communities From Fecal Samples In Kenya

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)2.717Long. (o)37.1Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036964Metagenome / Metatranscriptome169Y

Sequences

Protein IDFamilyRBSSequence
Ga0116637_10058053F036964AGGAGGMEILKIIFPLLMVAGALGSLVVNIASKGDWATSLQWLGACLLYTALTVRNMS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.