NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0117797_1000035

Scaffold Ga0117797_1000035


Overview

Basic Information
Taxon OID3300013938 Open in IMG/M
Scaffold IDGa0117797_1000035 Open in IMG/M
Source Dataset NameHuman gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 235
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChalmers University of Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)22338
Total Scaffold Genes41 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (14.63%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Unclassified → Unclassified → Human Gut → Human Gut Microbial Communities From Patients With Symptomatic Atherosclerosis - Chalmers University Of Technology

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F089054Metagenome109N

Sequences

Protein IDFamilyRBSSequence
Ga0117797_100003535F089054N/AMLTKGKFLVSFEVPGHTKEYTEGFTEEMVIPYRTEELNPYLRYPNQRINNNHLHSEHIRLQIRDILQIPLTDITIIDIISLP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.