Basic Information | |
---|---|
Taxon OID | 3300013948 Open in IMG/M |
Scaffold ID | Ga0116699_1046239 Open in IMG/M |
Source Dataset Name | Coral microbial communities from a home aquarium in Belgium - AM-T0-control A |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Mons |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 660 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Acroporidae → Acropora | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral Tissue → Coral Microbial Communities From Home Aquarium In Belgium And Reunion Island, France |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Belgium: Mons, Walloon Region | |||||||
Coordinates | Lat. (o) | 50.45 | Long. (o) | 3.93 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013845 | Metagenome / Metatranscriptome | 267 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0116699_10462391 | F013845 | GAG | MTVEKPKPKQLLRPITTGAGSAMNQSEFLAITCNSLKAREESRVHGAIGFGFASDWLKNWRESFKPITKRSNRDHVITFDS |
⦗Top⦘ |