Scaffold Ga0120381_1014326

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0120381_1014326

Scaffold Ga0120381_1014326

Overview

Basic Information
Taxon OID	3300014047 Open in IMG/M
Scaffold ID	Ga0120381_1014326 Open in IMG/M
Source Dataset Name	Sheep rumen microbial communities from Wyoming, USA - O_aries_Forg_1003
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Missouri
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2060
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (87.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Sheep Rumen → Ruminant Gut Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location Name	USA: Wyoming
Coordinates	Lat. (^o)	41.314168	Long. (^o)	-105.584589	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069538	Metagenome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0120381_10143267	F069538	AGGAG	MLEVIQEEDKSKCRKDLDYIKLSLSNLRVGHSQLMLDLPLDYHSEDFDEAFMELVDELEDLIKDYEDRRL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.