Basic Information | |
---|---|
Taxon OID | 3300014050 Open in IMG/M |
Scaffold ID | Ga0119952_1015626 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Georgia Institute of Technology |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2725 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier In Georgia, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Georgia | |||||||
Coordinates | Lat. (o) | 34.21 | Long. (o) | -83.96 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F024038 | Metagenome | 207 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0119952_10156263 | F024038 | AGGA | MDQETYVEQIAEYILYELWFSVAEALFDRVANATELDDEQRVALRAVALRPNDFQVHVVEE* |
⦗Top⦘ |