NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120384_1175212

Scaffold Ga0120384_1175212


Overview

Basic Information
Taxon OID3300014057 Open in IMG/M
Scaffold IDGa0120384_1175212 Open in IMG/M
Source Dataset NameSheep rumen microbial communities from Wyoming, USA - O_aries_Forg_1208
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Missouri
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)733
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Sheep Rumen → Ruminant Gut Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)41.314168Long. (o)-105.584589Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011198Metagenome / Metatranscriptome294Y

Sequences

Protein IDFamilyRBSSequence
Ga0120384_11752121F011198N/AMEKYRPKSAMLVKGNNNTYFSSKPSNNAFSKTFFIQEKETGDKYFRSTRVGSCRKIVVKNGIPFALTFKVKNPRGEPLTHFNYTLKQFPKNPTSYYLDYCTKRRENHLGMDKKPLVPYNPNHTRSQLPNDLSFRVIRNYSEFNIGNEGLINRKQWISTYRDSYRPSSVKRISNPGILSDMAKRTHYKLNNIEYACSKL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.