Basic Information | |
---|---|
Taxon OID | 3300014060 Open in IMG/M |
Scaffold ID | Ga0119967_10189451 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Crystal Geyser, Utah, USA - CG_3.0 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of California, Berkeley |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 975 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Geyser, Utah, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: near Green River, Utah | |||||||
Coordinates | Lat. (o) | 38.938 | Long. (o) | -110.08 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F014684 | Metagenome / Metatranscriptome | 261 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0119967_101894511 | F014684 | N/A | SSMLEMNKIVWKRYYYRVMGFIAVGSGAGLILDELIHGPFTLTPANHEFWGIVAIIIGCVLISKAPHGKD* |
⦗Top⦘ |