NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119967_10379313

Scaffold Ga0119967_10379313


Overview

Basic Information
Taxon OID3300014060 Open in IMG/M
Scaffold IDGa0119967_10379313 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Geyser, Utah, USA - CG_3.0
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of California, Berkeley
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)572
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Geyser, Utah, Usa

Source Dataset Sampling Location
Location NameUSA: near Green River, Utah
CoordinatesLat. (o)38.938Long. (o)-110.08Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F091327Metagenome107N

Sequences

Protein IDFamilyRBSSequence
Ga0119967_103793131F091327N/AITISDDEEAFANEFSAKVSEENDTYVDTVLIELAIAQILQVHRVYVYAKEKKISRDASRMIGTVLSTLREMNATKNARKEDNIKVTVNSDIMTLIQQNLNLISNDDGKKRNNILKK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.