NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181521_10003945

Scaffold Ga0181521_10003945


Overview

Basic Information
Taxon OID3300014158 Open in IMG/M
Scaffold IDGa0181521_10003945 Open in IMG/M
Source Dataset NamePeatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17197
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (69.23%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)47.1149Long. (o)-88.5476Alt. (m)Depth (m).6 to .7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048954Metagenome147Y
F104378Metagenome / Metatranscriptome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0181521_100039455F104378GAGMSAVAAAILLASSTGVGQTPEQEKSWEADRARAIAEEKVKAESLARERAARKADPMAWVRTLDPMSTGGWEFRAVANDGSWATYSSTHQLKRSGQVVTVWLRQEYAEPQLGGGGPYLSVVEKTQYDCKRDQARALLVIYYTANNVQGSEQTEEGDAKSTPWNAIIPGTREEMNFLWACGQARGASVK*
Ga0181521_100039457F048954N/AMARRRNTHDPLEATGAPRWYVVRSMHGTVIESRELPSGVDLKRAFVVAMLQWIDAGWKLGEFSSGSATFFCDRNPERRMVSIDPTDPHDVPMYGGAHLGGCRHCGD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.