NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181538_10204254

Scaffold Ga0181538_10204254


Overview

Basic Information
Taxon OID3300014162 Open in IMG/M
Scaffold IDGa0181538_10204254 Open in IMG/M
Source Dataset NamePeatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1107
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)47.1149Long. (o)-88.5476Alt. (m)Depth (m).3 to .4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037313Metagenome / Metatranscriptome168Y
F042445Metagenome / Metatranscriptome158Y

Sequences

Protein IDFamilyRBSSequence
Ga0181538_102042541F042445N/ANKAIPAKPRAATIAIWLPILALAAALTSGCSQVHEKMFTLNCAIGREPIAGELAPGTAMAIDVSTSPIPLISAPHRVIARCDNAGAVTMYLETPVDTGLSELSTPLSTAASHVTYAP*
Ga0181538_102042542F037313GGAGMSLKIRKLPGPFLCACVMLVAGCAQQGGGLLQPTPKQIISGKNTIVPSAAALSMEATNFCNAQAQVDYAGLVLYCEGKTPALPLSISTTYQTEANEFSCQVYGYTNSSNQLIVPQTVTLGNCPTGVAPAPVTAPSGASTALKAS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.