NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181523_10155368

Scaffold Ga0181523_10155368


Overview

Basic Information
Taxon OID3300014165 Open in IMG/M
Scaffold IDGa0181523_10155368 Open in IMG/M
Source Dataset NamePeatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1344
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)47.1149Long. (o)-88.5476Alt. (m)Depth (m).3 to .4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020582Metagenome / Metatranscriptome223Y
F044377Metagenome / Metatranscriptome154Y
F060540Metagenome / Metatranscriptome132Y

Sequences

Protein IDFamilyRBSSequence
Ga0181523_101553681F060540N/AARGRGKFVRLSEAGIKAQQEYYNRTRDIEKNWKKRFRTATKEIRESLTTLLKRGELSDGLKPPPGTTRAGAQTPALGRVDIGSAARQRKRDLVVQTEAFVRDPAGTLPHYPLWDMNRGFGP*
Ga0181523_101553682F020582GGAGGMKEARAKKKTPRIRLPRATASYTELSDFFDHHDGFDLLDQGITEVDPDRSDLDRMLLEYWNQANTKQLNIRIPPAAKRMIEKLAKRKTVEVSTLVRMWVIDSMRREASQP*
Ga0181523_101553683F044377N/AVAVFVESAFKHGYDEGDYFEVLDTGRLKLRSRRGLKGVYELYGRNYAGEYLHIAYRRDRDQEVVFHMCAMSPHEKRRYRSL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.