Scaffold Ga0181531_10000369

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0181531_10000369

Scaffold Ga0181531_10000369

Overview

Basic Information
Taxon OID	3300014169 Open in IMG/M
Scaffold ID	Ga0181531_10000369 Open in IMG/M
Source Dataset Name	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	31024
Total Scaffold Genes	30 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	23 (76.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location Name	USA: Michigan
Coordinates	Lat. (^o)	47.1149	Long. (^o)	-88.5476	Alt. (m)		Depth (m)	.1 to .2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007229	Metagenome / Metatranscriptome	355	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181531_100003695	F007229	AGGAG	VALIPKIEPKQEKKLVSARLDEEAHTLLQRYAAFLGGATHEYIIDESLKRLFRRDKEFNEWLAKQQAGSATVSRAGNTSSPDLKISAKSVPSAA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.