NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0172377_10141908

Scaffold Ga0172377_10141908


Overview

Basic Information
Taxon OID3300014206 Open in IMG/M
Scaffold IDGa0172377_10141908 Open in IMG/M
Source Dataset NameLeachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2147
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate → Leachate And Groundwater Microbial Communities From A Municipal Landfill And Adjacent Aquifer In Southern Ontario, Canada

Source Dataset Sampling Location
Location NameCanada: Ontario
CoordinatesLat. (o)43.442Long. (o)-80.577Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067770Metagenome / Metatranscriptome125N
F078767Metagenome / Metatranscriptome116N

Sequences

Protein IDFamilyRBSSequence
Ga0172377_101419082F067770GAGMIEFKYNSPVFKLGKISRSEWRELGMSARSEIVKRTRNGIDINHQPFHEYSAATQEYKSGIMQTRGLGSSVVTLQDTGQMHRSLSVEVQANAAILYYADQNRAKIALKHQTGDNRLPKREHFGFNKTDGNKYLEKIAKLQTIKNKKANR*
Ga0172377_101419083F078767AGAAGGMTNQITDITDEILIALREAGCRTVGILPEVLMFSGNNNPFGFILLNSETTENDNGGILTQLLDISIFIITQNGINKTKEHCNVLYAAIGKILNSSGLNSKTALVNLETINWHADMPFVTQLVGDLDIISSISFNIKYMNAR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.