NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182000_10045516

Scaffold Ga0182000_10045516


Overview

Basic Information
Taxon OID3300014487 Open in IMG/M
Scaffold IDGa0182000_10045516 Open in IMG/M
Source Dataset NameBulk soil microbial communities from Mexico - Magueyal (Ma) metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1293
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location
Location NameMexico: Magueyal, Guanajuato
CoordinatesLat. (o)21.195Long. (o)-100.439Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004047Metagenome / Metatranscriptome455Y
F009317Metagenome / Metatranscriptome319Y
F033946Metagenome / Metatranscriptome176Y

Sequences

Protein IDFamilyRBSSequence
Ga0182000_100455161F009317GGAGMTPEHALPGTRVRVMEHHRVEQRRGLVGTVVARYGGEDYVAVDVRLADGRYRLFWPRDLEEIFPSSPKASWWRLLLGGSAEG*
Ga0182000_100455162F004047N/AMAEEVLMRQAKVLAQRSGHSLEDARRAVSDTEAGRQLRDLAAGKHRHEKAYYWRASVFWERAEERFMHQIGSEALSRFAAARPYTWLESYMERLEGKEARAR*
Ga0182000_100455163F033946GAGMPSEEARIGKRVRIRADHRSKALRGLEGTIEKRWGNPDHVALDVLLDDGHSELFWYHELEEIAERLSSGT*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.