Scaffold Ga0182001_10285756

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0182001_10285756

Scaffold Ga0182001_10285756

Overview

Basic Information
Taxon OID	3300014488 Open in IMG/M
Scaffold ID	Ga0182001_10285756 Open in IMG/M
Source Dataset Name	Bulk soil microbial communities from Mexico - San Felipe (SF) metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	659
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location
Location Name	Mexico: San Luis Potosi
Coordinates	Lat. (^o)	21.766	Long. (^o)	-100.163	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042771	Metagenome	157	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0182001_102857561	F042771	AGGAGG	MYSQRQEDLGSFSSHLEAKKAGPLVCPICSQTNTILPKGAPIGEPSGEPVIESEPRFAYAACTNCGYSIFFDTEYLPERRSS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.