NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182015_10000202

Scaffold Ga0182015_10000202


Overview

Basic Information
Taxon OID3300014495 Open in IMG/M
Scaffold IDGa0182015_10000202 Open in IMG/M
Source Dataset NamePermafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)85895
Total Scaffold Genes88 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)59 (67.05%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Stordalen
CoordinatesLat. (o)68.35Long. (o)19.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000321Metagenome / Metatranscriptome1304Y
F002076Metagenome / Metatranscriptome596Y

Sequences

Protein IDFamilyRBSSequence
Ga0182015_1000020224F000321GAGLGELSTSINDALLAVDLNMVELVKLQSRQKQTGRETQVVILNRLRKRIHQVSKKRNCSMNQLVNSALLAYYSKSGQAKLKKPAKGLGSSVHSYDTMSEGERRELHQVLAQVSAMQPVPFEAEEPNGTYYEYDRNLKATVKVTPDGERTPVEKLETSFEPTRPKGPRKAAHEGIAS*
Ga0182015_1000020226F002076GAGMEHFRQCLNKLAATPPQKKAALIRSLLPGIETALRCGHGLKEIWVALGGEGLQMSYRVFHQTVSRSRNAKKPTAPSSWGKQDKPPEARDAQGTKVEAVEERDPFANLRRLEPENRPGFHWRGTRNVKTPVPGTED*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.