NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182011_10249326

Scaffold Ga0182011_10249326


Overview

Basic Information
Taxon OID3300014496 Open in IMG/M
Scaffold IDGa0182011_10249326 Open in IMG/M
Source Dataset NamePermafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1192
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Stordalen
CoordinatesLat. (o)68.35Long. (o)19.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000451Metagenome / Metatranscriptome1124Y
F018347Metagenome / Metatranscriptome235Y

Sequences

Protein IDFamilyRBSSequence
Ga0182011_102493262F000451GGAGGMPRFQTVVRKARFVYSPYTATEMQGFAQVLADTIRARIQSGQNVYDQAAAPLKPGKPGRRGYPDYKAARGLKPIRDWTWSGHTLRCLKVLTTNENRAAIGFLDEAMPGRRQTASQIAFYNNQRERQWGVSPRDRQAVMSVMLNYRPLVTLQDMSQGAYFRGLRQFGFGQYINSIPMAA*
Ga0182011_102493263F018347GGCGGMADQAERVILEAEDQVTPVVGQANAGLDSFEKKAESAHGKVVRITDQTRSSIQRLIASLEKQAEVYGKSGADRLISQRDQLLQRYAKEPAAIDAITRSYEKMIAVEEKAAREAAVVKAAKEAEGALRSQSEAIKSFGDRVGQFMENPLQGARGAVSSVLSSLGPFGMGVM
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.