NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134397_106341

Scaffold Ga0134397_106341


Overview

Basic Information
Taxon OID3300014537 Open in IMG/M
Scaffold IDGa0134397_106341 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from obese patients in Germany - AS60_12
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hohenheim
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1705
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany

Source Dataset Sampling Location
Location NameGermany
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F097493Metagenome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0134397_1063416F097493N/AYGIHTDRDIQRIKRRIVNDKFAETDDNFDMDTEIAKIQHTDVTFEQPTSEKLSQIQAKTYNSMSELKQHVQSVMNGDETMSQDEINAMLMLQIAELKAGVDGE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.