NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134369_100104

Scaffold Ga0134369_100104


Overview

Basic Information
Taxon OID3300014571 Open in IMG/M
Scaffold IDGa0134369_100104 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from obese patients in Germany - AS60_0
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hohenheim
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)123927
Total Scaffold Genes139 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)42 (30.22%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct1h53(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany

Source Dataset Sampling Location
Location NameGermany
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F099406Metagenome103N

Sequences

Protein IDFamilyRBSSequence
Ga0134369_10010444F099406N/AMAEVGYNSKFEGLEVDSRLENVVQAAPGTGSESGKGGLIPAPPAGSQDGNKTLLSNMTWGDHVTKQYVDDAVSAAGWKKQIVSKLPTVEEAKDNVMYLVKDDVASTETKNVYNEYILVTEGGGTKVLESLGMVSTGVDSGYLDLSIFSGNSGSLDENSFAKVLDAYNNNITLGKLDGDYYYLNYFLEGNDFENNFKLKIVFASFANIDSAVGASEYDIEIQVGTFVVIQDKTYKAMNNMVTLSNTILSYLNFMAMPPKVVTTLADLPKGAHNIIANVASATKLSMTVSSEDVGREWQVRVNNTTDTDITQPLPTSGRFQSMSGNSVVIPKISFIELSIWYINDKLVIRVGE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.