NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0180008_1195283

Scaffold Ga0180008_1195283


Overview

Basic Information
Taxon OID3300014613 Open in IMG/M
Scaffold IDGa0180008_1195283 Open in IMG/M
Source Dataset NameGroundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - MM_PW_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)778
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe

Source Dataset Sampling Location
Location NameSweden: Oskarshamn
CoordinatesLat. (o)57.4344Long. (o)16.66Alt. (m)Depth (m)171
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F066535Metagenome / Metatranscriptome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0180008_11952832F066535AGGAGMSLQSWGETLITSQVDGPALTAAAAATALPAAAKYTLPANFFSLGKQLLIEASGRISSVITTPGTARFDVRFGATVVFDGLAVLLDSVAAHTNVGWRLKIQMTCRAIGATGNLFGQGRWTCEDILGVPATAPKGVLTAILPWNSAPAVGNNFDTTASQVVDLFFTQTAATGSMTVH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.