NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181525_10145225

Scaffold Ga0181525_10145225


Overview

Basic Information
Taxon OID3300014654 Open in IMG/M
Scaffold IDGa0181525_10145225 Open in IMG/M
Source Dataset NamePeatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1301
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)47.1149Long. (o)-88.5476Alt. (m)Depth (m).1 to .2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074512Metagenome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0181525_101452252F074512AGGAGVNAVLLLSALIGATLIVVRGTICRPIQKLWPALFGCSQCTGTWVGIAAGASGIVSVGQGRMVDAIVVGAATSFLSMLADAVLLKLLGDPNEKEGR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.