NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181519_10009522

Scaffold Ga0181519_10009522


Overview

Basic Information
Taxon OID3300014658 Open in IMG/M
Scaffold IDGa0181519_10009522 Open in IMG/M
Source Dataset NamePeatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7362
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (70.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)47.1149Long. (o)-88.5476Alt. (m)Depth (m).1 to .2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002448Metagenome / Metatranscriptome558Y
F007294Metagenome / Metatranscriptome353Y

Sequences

Protein IDFamilyRBSSequence
Ga0181519_1000952210F002448N/AMTNPKTILAEWVTALQALPNLVDALGGDGSYIQFYTENAVVFGQPTQNNIRLAILSMPPGSIMIAWQGTGPGRLGNALVFVHDFSLYLRAPEEADVGYEDLFHWIVNDVPAGSSLRMLHTAVDPNCEPMDFYLPSARRNTVVISPDGATFEYF
Ga0181519_100095222F007294GGAGGMALTVLQLQANLDAINQALGNPTLKVRFPDGREVTYRSVDDLRKAKAEIEEDSRQASGQTGRRVRFAQHQRGDGPTGPSMSDRW*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.