Basic Information | |
---|---|
Taxon OID | 3300014711 Open in IMG/M |
Scaffold ID | Ga0134314_106680 Open in IMG/M |
Source Dataset Name | Surface water microbial communities from Bangladesh - BaraHaldiaSW0111 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Tennessee |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 752 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water → Surface And Well Water Microbial Communities From Bara Haldia, Bangladesh |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bangladesh: Bara Haldia, Matlab upazilla | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F096876 | Metagenome / Metatranscriptome | 104 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0134314_1066804 | F096876 | GAG | MTDQVERIAVLEAEVRGLKEDQQEILVCMHSIKDEMTRYKGFLGGIAFLASGVGIF |
⦗Top⦘ |