Scaffold Ga0134337_100350

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134337_100350

Scaffold Ga0134337_100350

Overview

Basic Information
Taxon OID	3300014766 Open in IMG/M
Scaffold ID	Ga0134337_100350 Open in IMG/M
Source Dataset Name	Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_114
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	The George Washington University (GWU)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	22940
Total Scaffold Genes	15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (6.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Alloprevotella → Alloprevotella sp. oral taxon 473	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral → Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa

Source Dataset Sampling Location
Location Name	USA: Maryland
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085820	Metagenome	111	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134337_1003506	F085820	N/A	MRSTFYLFAVLFLATTFFSCETVEPSPRPTWGEIVNPIEAFMYPRDLKVFADGEEGRRWLILVVPDSTKSSFAPTSKSTPAEVARYKELSQLVGNPTEPVANECHFHRTWLTQGVKAIRVVRTQADGRDEEVTAQCGNLYFYTDKQIFDCQFKCGNRSIFAKPLGEVVEADYLWLPGIDVFGLLAPPNPDHLKQRIVLRLADGTEIEKELSEKGKK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.