Scaffold Ga0119815_1000665

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119815_1000665

Scaffold Ga0119815_1000665

Overview

Basic Information
Taxon OID	3300014815 Open in IMG/M
Scaffold ID	Ga0119815_1000665 Open in IMG/M
Source Dataset Name	Human oral microbial communities from Los Angeles, CA, USA - S21-03-R
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of California, Los Angeles
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	28370
Total Scaffold Genes	25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (32.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral → Human Oral Microbial Communities From Los Angeles, Ca, Usa

Source Dataset Sampling Location
Location Name	USA: Los Angeles
Coordinates	Lat. (^o)	34.0722	Long. (^o)	-118.4441	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094006	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119815_10006658	F094006	GAGG	MWSALEPAGPTGALYESTVCVEAHIGELQTGGIACRGLFAFEGSNVLAVAELGAEAPHAIDMYDIALCKPLSELFAKELEYAFNFGA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.