Scaffold Ga0182027_12044316

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0182027_12044316

Scaffold Ga0182027_12044316

Overview

Basic Information
Taxon OID	3300014839 Open in IMG/M
Scaffold ID	Ga0182027_12044316 Open in IMG/M
Source Dataset Name	Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	547
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location Name	Sweden: Stordalen
Coordinates	Lat. (^o)	68.35	Long. (^o)	19.05	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057791	Metagenome	135	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0182027_120443161	F057791	GGA	MNITTSAKIFIAMERICLDRLLKQRSALRKPGMPFDFPPQRGGLWSLSVGVGCNATNSGALSELLS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.