NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134572_100378

Scaffold Ga0134572_100378


Overview

Basic Information
Taxon OID3300014931 Open in IMG/M
Scaffold IDGa0134572_100378 Open in IMG/M
Source Dataset NameHuman fecal microbial community from subjects in taly - 20011
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bologna
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5608
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (46.15%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct1h53(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy

Source Dataset Sampling Location
Location NameItaly
CoordinatesLat. (o)44.4950537Long. (o)11.3427401Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074964Metagenome119N

Sequences

Protein IDFamilyRBSSequence
Ga0134572_1003781F074964N/AMITKKNVNKLQNAVIKENASNLVGAVKLYNALFANGADLKAVCKALEIPAEYAVKVAALAKDKKRLVAVCSQMLPKVGDTFIKFSLYSKVYKDNKVDKEKGIEAKTADWCADNVVYGSEYKPFGFATAETLETKSSAKWIVKETDEYKSTYVAVKIKSYSIRTVAKCVSEYLAHESNQQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.