NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167661_1026303

Scaffold Ga0167661_1026303


Overview

Basic Information
Taxon OID3300015167 Open in IMG/M
Scaffold IDGa0167661_1026303 Open in IMG/M
Source Dataset NameArctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bristol
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1081
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location NameStorglaci?ren, Tarfala, Sweden
CoordinatesLat. (o)67.904687Long. (o)18.610965Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003832Metagenome / Metatranscriptome466Y
F005268Metagenome / Metatranscriptome406Y
F058360Metagenome / Metatranscriptome135Y

Sequences

Protein IDFamilyRBSSequence
Ga0167661_10263031F058360N/AVPQVEATITTSTFTMALAGSGAMSDPDASFMLKVEQAVDRVLSRSDWPRPTTKGNRIVSRKPNPEEGN*
Ga0167661_10263032F003832GAGMQSTAEKLRSEAQWPPEEGEVITFTSSAGSETAILKEVRWGLVWRDFILEDGRVIPEHRISGCPQPQVWRKIDEVTDDEREDCEERLLSMAGSGMDPRQRDQSFWAELNQYLAYTYLRYKQAAGRVQDKMQETER*
Ga0167661_10263033F005268GAGGVTRSEETEDQKTWRALSEAGLVEIRLDEFAERIADVKRIVIVRLRELLDFDNGIKERESAAYSLGTLKGLELKVLANAPPPTDPSEV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.