Basic Information | |
---|---|
Taxon OID | 3300015170 Open in IMG/M |
Scaffold ID | Ga0120098_1016685 Open in IMG/M |
Source Dataset Name | Fossil microbial communities from human bone sample from Teposcolula Yucundaa, Mexico - TP48 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Harvard University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 869 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Fossil → Unclassified → Fossill → Fossil Microbial Communities From Human Bone And Soil Samples From Teposcolula Yucundaa, Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mexico: Teposcolula Yucundaa | |||||||
Coordinates | Lat. (o) | 17.550556 | Long. (o) | -97.425556 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F057184 | Metagenome | 136 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0120098_10166851 | F057184 | GAGG | MTKLIVLSCLVSPLILNNEALAQNQSRSDILDLDIQGVSAFVPEDRNIYTITGEVFNNNTFPFNGVQVSATLYDNNGQVVGVGSDFTSPSGIQSGIKAPFKVDSFGTEIMGGIDAVNNYTLQVTGDLQIQLFQ* |
⦗Top⦘ |